同服IP站点列表(144)
- Tapias Prefabricadas casas prefabricadas Costa Ricaconcretosjc.com
- HOME - Gkbanglagkbangla.com
- Welcome - Tucker Civic Associationwww.tuckercivic.org
- SLOT88 | DAFTAR 8 SITUS SLOT ONLINE TERGACOR DAN MUDAH MENANG 2022- MULIA SLOT 88www.interstaterestaurant.com
- Intesa Costa Ricawww.intesacostarica.com
- Welcome - Tucker Civic Associationtuckercivic.org
- NWIIZONE138 - Daftar Link Alternatif Situs Judi Slot Online Gacor Mudah Menangwww.nwiizone.com
- Errorwww.danewengland.org
- Kitale Family House of Hopewww.kitalefamily.org
- Tapias Prefabricadas casas prefabricadas Costa Ricavibracompactado.com
- Nullnayabsrogue.com
- Gulu Agricultural Development Company | Providing market access to smallholder farmers in northern Ugandagadc.co.ug
- homebrewingguides comhomebrewingguides.com
- Strike A Pose With Victoria Harbus IFBB Pro League amp IFBB Pro League Champion 8211 The Ultimate Guide To Strike A Winning Pose Presented by Victoria Harbusstrikeapose.us
- HAISO 8211 New York based Website and APP Design and Development Studiohaiso.digital
- APK05apk05.com
- My account 8211 Priv8priv8.store
- shareholdernewz comshareholdernewz.com
- Nullkemenanganhoki.review
- Arena Coinarenacoin.gg
- Your Storelottotrade.com
- Home mdash Alaadunalaadun.com
- catnewsonline comcatnewsonline.com
- Home | Earthy Shopping amp Giftsktree.com.au
- Zuri Websites Limited 8211 Nairobi Website Designerszuriwebdesign.com
- Mini Puppies Home 8211 Beautiful puppies for salewww.minipuppieshome.com
- onlinestockinvestor comwww.onlinestockinvestor.com
- CDC Advertising Tools Inc | Online Store 8211 CDC Advertising Tools Inccdcati.net
- Ghana Learns 8211 Learning Everything In Ghana Education Scholarships Admissions amp Guides In Ghanaghanalearns.com
- How to Invest in Diem Libre Coin 8211 How to Buy Diem Cryptocurrency 2021 8211 Trending news10000584866.info
- Dave n 039 Jasperwww.davenjasper.com
- Classner Training 8211 Eminent Training Platformclassner.net
- Welcome to DATAHOUSE | Buy Cheap data and make bill payment easilywww.datahouse.com.ng
- Indira Ranamagar Biography -www.indiraranamagar.com
- Schnell Fotografikwww.schnellfoto.com
- Home - Agri News Africaagrinewsafrica.com
- Rickman Holdings Ltd - Homerickmanholdingsltd.com
- Adeolabtc com 8211 Cryptocurrency Exchangeadeolabtc.com
- Mangaku – Adalah situs baca komik online berbahasa Indonesiawww.mangaku.vip
- Roof Plot Gardening | We help you to make your roof top gardening in a much better waywww.roofplot.com
- Pekalongan Pedia - Sosial Media Marketing Solution Termurahpekalonganpedia.com
- Down Range Ammunition 8211 Hunters amp Shooters|Cheap Ammo and Gun Onlinedownrangeammunition.com
- Winsome Puppies Home 8211 Adorable puppies for sale onlinewinsomepuppieshome.com
- Unknownonlinestockinvestor.com
- Parked Domain name on Hostinger DNS systemminipuppieshome.com
- Site is undergoing maintenancewww.digitalmarketingtracks.com
- Nullschnellfoto.com
- The Velvette 8211 Company is a soft commodities trading companythevelvettecompany.com
- ???????????????????????????????? ???????????????????????????????????? ???????????????????????????????????????????? ???????????????????????????? 8211 Advanceadvancedprecisions.com
- JetToken - Brewed on the Moon | JetTokenwww.jettoken.org
- Luke Nicol 8211 Paintings amp Drawingslukenicol.com
- onlinemusicnewz comonlinemusicnewz.com
- sportsnewzonline comsportsnewzonline.com
- vecocapital comvecocapital.com
- myfitnessnewz com 8211 Fitness Guidesmyfitnessnewz.com
- Home - Cell Press GHcellpressgh.com
- onlinecreditnewz com 8211 credit webdm websiteonlinecreditnewz.com
- Digital Marketing Agency Welshpool - Seven Street Marketingsevenstreetmarketing.com
- Deliverance House 8211 Deliverance Books Audiobooks Dreams and Interpretations DVDS CD with a clickdeliverancehouse.org
- Nullrecruitment.pekalonganpedia.com
- Angles Tradeanglestrade.com
- Dr Abdul Aziz Al Shamsi 8211 Advocates amp Legal Consultantsalshamsilaw.ae
- Easyuploader io — Upload File — Free File Hosting amp Sharingeasyuploader.io
- natshowshop - natshowshopnatshowshop.de
- Custom Boxes Custom Printed Boxes Custom Packaging Boxes Custom Box Custom Box Packaging - King Custom Boxeswww.kingcustomboxes.com
- onlinegadgetsnewz comonlinegadgetsnewz.com
- BlackTECH | Career Acceleration | Entrepreneurship Developmentblacktechhub.org
- forexnewzonline comforexnewzonline.com
- Sukaslot88 Situs Judi Slot Nexus Terpercaya | Agen Judi Online Deposit Pulsadaftarslotnexus.org
- StartUpyme 8211 Recursos Humanos Capacitaci oacute n para Pymeswww.startupyme.cl
- Welcome to Intergraidwww.intergraid.com
- Home - Osix Africaosixafrica.net
- Unknownhotelbookingcalculator.com
- Exodus Crypto | The Smarter Way To Investexoduscrypt.com
- Ibera Financial Investmentsiberiafinancialinvestments.com
- Unknowncarrentalcalculator.com
- Krypto Investmentkryptovesta.com
- Nullokcgfx.com
- Hao Tian Finance Company Limitedhianfinance.com
- Site is undergoing maintenancewww.dreamintlconsultancy.com
- Online Courses | classnerclassner.com
- Charity 8211 Fundraising Websiteglorystepsinitiative.com
- Nullcookiemiee.com
- Home page | Wordpress marketingsyncplandigitalmarketingservices.com
- Ernie Shaw 8211 Welcome to Black Cyclingwww.ernieshaw.com
- sportsbettingnewz comsportsbettingnewz.com
- ShortWaysLogisticshortwayslogistics.com
- Rubicoin Invest - Homerubicoininvest.com
- Humorous eCards - Share Send amp Smilehumorousecards.com
- Dream • Explore • Enjoy and Discoverflightfarecalculator.com
- Decentraagedecentraage.com
- Home | MAVERICK MININGwww.maverickmining.com
- Unknownmetastarter.io
- oleander pk 8211 oleander pkoleander.pk
- Bitfury Investmentbitfuryinvesta.com
- Index ofrexmyguy.com
- Tip News 8211 Your Everyday Educational Tips And Scholarship Newstipnewsgh.com
- Đăng nhậpphubinhgroup.com
- My insurance calculator 8211 I consent to calls and text messages transmitting insurance AND WARRANTY quotesmyinsurancecalculator.com
- Qubitech Investment - Homequbitechinvest.com
- Stockxness Investmentwww.stockxness.com
- Home | MerQat Learning Platformmerqat.net
- Unknownmatrixtron.live
- Unknownflightsreservationsdesk.com
- Earn Tradeness - Homewww.earntradeness.com
- Moon Life Investment | Moon Life Investmentwww.moonlifenvest.com
- Unknownwww.upscnews.in
- Raph Sark 8211 Latest Education Tips Schools And Scholarship Blographsark.com
- Ping Ball Discounts 8211 Ping Ball Discountspingballdiscounts.com
- kamaoweb 8211 kamaowebkamaoweb.com
- MaceDigitalStores | We offer instant recharge of Airtime Databundle CableTV DStv GOtv Startimes Electricity Bill Payment and moremacedigitalstores.com
- My Blog 8211 My WordPress Blogwww.stepshoestore.com
- The Our Don 8211 ourdon comwww.ourdon.com
- Home - Trends In GHtrendsingh.com
- Mortgage Guru 8211 We help everyday people take full advantage of grants stimulus and moremortgagereliefcash.com
- The Our Don 8211 ourdon comourdon.com
- My Blog 8211 My WordPress Blogstepshoestore.com
- Moon Life Investment | Moon Life Investmentmoonlifenvest.com
- Free Fire Redeem Codes Today 100 Working All Server Redeem Codewww.freefireredeemcode.info
- DAFTAR 8 SITUS SLOT ONLINE TERBAIK 2021 - MULIASLOT88interstaterestaurant.com
- وفاق المدارس الاسلامیہ الرضویہ انٹرنیشنل رجسٹرڈwmir.org
- Index ofstripbang.fun
- Glamoria Gems - Independent Gems and Jewelry Appraisal Expertglamoriagems.com
- יובל טורצ 039 נסקיyuvaltorch.com
- Chartered Courier and Logistics 8211 Global Logistic and Shipping Companycharteredlogistic.com
- MAGBEI GAMESmagbei.com
- Personal amp Business Banking | Banking Excellence | Upstream Trust Bankupstreamtrust.com
- Laoyescent 8211 Home of Beautiful scentwww.laoyescent.com
- Flight Booking Booth 8211 Get Bookings Cancellation Changes Customer Service Refundsflightbookingbooth.com
- Home - I m Bethimbeth.com
- Translate05 com 8211 Translate Your texttranslate05.com
- Home - I m Bethwww.imbeth.com
- Language Translatortahir.translate05.com
- CashFxauwww.cashfxau.com
- Home - Japan Lanka Newsjapanlankanews.com
- Financial Associates B ham Limited | Offshore Private Bankingfinancialassociatesbhamlimited.com
- Sunreeth Water Solutionsunreethwatersolutions.in
- Ashley Dachshund Puppies Home 8211 Buy dachshund puppies onlineashleydachshundpuppieshome.com
- Charming corgi puppies 8211 Charming corgi puppies for salecharmingcorgipuppies.com
- Nullwww.finexiamarkes.com
- Personal amp Business Banking | Banking Excellence | The Investment Federal Credit Unioninvestmentfcu.com
- Palestine Aidpalestinaid.org
- The Auto Diary - All About Vehicle Guidewww.theautodiary.com
- The Auto Diary - All About Vehicle Guidetheautodiary.com
